Anti DSG2 pAb (ATL-HPA004896 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA004896-25
  • Immunohistochemistry analysis in human rectum and liver tissues using HPA004896 antibody. Corresponding DSG2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cell junctions & vesicles.
  • Western blot analysis in human cell line BEWO.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: desmoglein 2
Gene Name: DSG2
Alternative Gene Name: CDHF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044393: 65%, ENSRNOG00000016526: 59%
Entrez Gene ID: 1829
Uniprot ID: Q14126
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNAS
Gene Sequence APPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNAS
Gene ID - Mouse ENSMUSG00000044393
Gene ID - Rat ENSRNOG00000016526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DSG2 pAb (ATL-HPA004896 w/enhanced validation)
Datasheet Anti DSG2 pAb (ATL-HPA004896 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DSG2 pAb (ATL-HPA004896 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DSG2 pAb (ATL-HPA004896 w/enhanced validation)
Datasheet Anti DSG2 pAb (ATL-HPA004896 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DSG2 pAb (ATL-HPA004896 w/enhanced validation)



Citations for Anti DSG2 pAb (ATL-HPA004896 w/enhanced validation) – 2 Found
Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38.  PubMed
Sun, Ruiying; Ma, Chao; Wang, Wei; Yang, Shuanying. Upregulation of desmoglein 2 and its clinical value in lung adenocarcinoma: a comprehensive analysis by multiple bioinformatics methods. Peerj. 8( 32095325):e8420.  PubMed