Anti DSE pAb (ATL-HPA014764)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014764-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DSE
Alternative Gene Name: DSEPI, SART2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039497: 87%, ENSRNOG00000000824: 89%
Entrez Gene ID: 29940
Uniprot ID: Q9UL01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYT |
| Gene Sequence | FRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYT |
| Gene ID - Mouse | ENSMUSG00000039497 |
| Gene ID - Rat | ENSRNOG00000000824 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DSE pAb (ATL-HPA014764) | |
| Datasheet | Anti DSE pAb (ATL-HPA014764) Datasheet (External Link) |
| Vendor Page | Anti DSE pAb (ATL-HPA014764) at Atlas Antibodies |
| Documents & Links for Anti DSE pAb (ATL-HPA014764) | |
| Datasheet | Anti DSE pAb (ATL-HPA014764) Datasheet (External Link) |
| Vendor Page | Anti DSE pAb (ATL-HPA014764) |
| Citations for Anti DSE pAb (ATL-HPA014764) – 1 Found |
| Tykesson, Emil; Hassinen, Antti; Zielinska, Katarzyna; Thelin, Martin A; Frati, Giacomo; Ellervik, Ulf; Westergren-Thorsson, Gunilla; Malmström, Anders; Kellokumpu, Sakari; Maccarana, Marco. Dermatan sulfate epimerase 1 and dermatan 4-O-sulfotransferase 1 form complexes that generate long epimerized 4-O-sulfated blocks. The Journal Of Biological Chemistry. 2018;293(35):13725-13735. PubMed |