Anti DSE pAb (ATL-HPA014764)

Atlas Antibodies

SKU:
ATL-HPA014764-25
  • Immunohistochemical staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells and islet cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dermatan sulfate epimerase
Gene Name: DSE
Alternative Gene Name: DSEPI, SART2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039497: 87%, ENSRNOG00000000824: 89%
Entrez Gene ID: 29940
Uniprot ID: Q9UL01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYT
Gene Sequence FRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYT
Gene ID - Mouse ENSMUSG00000039497
Gene ID - Rat ENSRNOG00000000824
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DSE pAb (ATL-HPA014764)
Datasheet Anti DSE pAb (ATL-HPA014764) Datasheet (External Link)
Vendor Page Anti DSE pAb (ATL-HPA014764) at Atlas Antibodies

Documents & Links for Anti DSE pAb (ATL-HPA014764)
Datasheet Anti DSE pAb (ATL-HPA014764) Datasheet (External Link)
Vendor Page Anti DSE pAb (ATL-HPA014764)



Citations for Anti DSE pAb (ATL-HPA014764) – 1 Found
Tykesson, Emil; Hassinen, Antti; Zielinska, Katarzyna; Thelin, Martin A; Frati, Giacomo; Ellervik, Ulf; Westergren-Thorsson, Gunilla; Malmström, Anders; Kellokumpu, Sakari; Maccarana, Marco. Dermatan sulfate epimerase 1 and dermatan 4-O-sulfotransferase 1 form complexes that generate long epimerized 4-O-sulfated blocks. The Journal Of Biological Chemistry. 2018;293(35):13725-13735.  PubMed