Anti DSCR3 pAb (ATL-HPA023288)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023288-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DSCR3
Alternative Gene Name: DCRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022898: 91%, ENSRNOG00000001681: 91%
Entrez Gene ID: 10311
Uniprot ID: O14972
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV |
| Gene Sequence | GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV |
| Gene ID - Mouse | ENSMUSG00000022898 |
| Gene ID - Rat | ENSRNOG00000001681 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DSCR3 pAb (ATL-HPA023288) | |
| Datasheet | Anti DSCR3 pAb (ATL-HPA023288) Datasheet (External Link) |
| Vendor Page | Anti DSCR3 pAb (ATL-HPA023288) at Atlas Antibodies |
| Documents & Links for Anti DSCR3 pAb (ATL-HPA023288) | |
| Datasheet | Anti DSCR3 pAb (ATL-HPA023288) Datasheet (External Link) |
| Vendor Page | Anti DSCR3 pAb (ATL-HPA023288) |