Anti DSCR3 pAb (ATL-HPA023288)

Atlas Antibodies

Catalog No.:
ATL-HPA023288-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Down syndrome critical region gene 3
Gene Name: DSCR3
Alternative Gene Name: DCRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022898: 91%, ENSRNOG00000001681: 91%
Entrez Gene ID: 10311
Uniprot ID: O14972
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV
Gene Sequence GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV
Gene ID - Mouse ENSMUSG00000022898
Gene ID - Rat ENSRNOG00000001681
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DSCR3 pAb (ATL-HPA023288)
Datasheet Anti DSCR3 pAb (ATL-HPA023288) Datasheet (External Link)
Vendor Page Anti DSCR3 pAb (ATL-HPA023288) at Atlas Antibodies

Documents & Links for Anti DSCR3 pAb (ATL-HPA023288)
Datasheet Anti DSCR3 pAb (ATL-HPA023288) Datasheet (External Link)
Vendor Page Anti DSCR3 pAb (ATL-HPA023288)