Anti DSCR3 pAb (ATL-HPA023288)

Atlas Antibodies

SKU: ATL-HPA023288-25

• 
• 

Protein Description: Down syndrome critical region gene 3
Gene Name: DSCR3
Alternative Gene Name: DCRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022898: 91%, ENSRNOG00000001681: 91%
Entrez Gene ID: 10311
Uniprot ID: O14972
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV
• Gene Sequence: GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV
• Gene ID - Mouse: ENSMUSG00000022898
• Gene ID - Rat: ENSRNOG00000001681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.