Anti DSCC1 pAb (ATL-HPA024401)

Atlas Antibodies

Catalog No.: ATL-HPA024401-25

Protein Description: DNA replication and sister chromatid cohesion 1
Gene Name: DSCC1
Alternative Gene Name: DCC1, hDCC1, MGC5528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022422: 87%, ENSRNOG00000026502: 92%
Entrez Gene ID: 79075
Uniprot ID: Q9BVC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQ
• Gene Sequence: KLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQ
• Gene ID - Mouse: ENSMUSG00000022422
• Gene ID - Rat: ENSRNOG00000026502
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.