Anti DSCC1 pAb (ATL-HPA024401)

Atlas Antibodies

Catalog No.:
ATL-HPA024401-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: DNA replication and sister chromatid cohesion 1
Gene Name: DSCC1
Alternative Gene Name: DCC1, hDCC1, MGC5528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022422: 87%, ENSRNOG00000026502: 92%
Entrez Gene ID: 79075
Uniprot ID: Q9BVC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQ
Gene Sequence KLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQ
Gene ID - Mouse ENSMUSG00000022422
Gene ID - Rat ENSRNOG00000026502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DSCC1 pAb (ATL-HPA024401)
Datasheet Anti DSCC1 pAb (ATL-HPA024401) Datasheet (External Link)
Vendor Page Anti DSCC1 pAb (ATL-HPA024401) at Atlas Antibodies

Documents & Links for Anti DSCC1 pAb (ATL-HPA024401)
Datasheet Anti DSCC1 pAb (ATL-HPA024401) Datasheet (External Link)
Vendor Page Anti DSCC1 pAb (ATL-HPA024401)