Anti DSCAM pAb (ATL-HPA057493)

Atlas Antibodies

Catalog No.: ATL-HPA057493-25

Protein Description: DS cell adhesion molecule
Gene Name: DSCAM
Alternative Gene Name: CHD2-42, CHD2-52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050272: 97%, ENSRNOG00000027992: 97%
Entrez Gene ID: 1826
Uniprot ID: O60469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK
• Gene Sequence: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK
• Gene ID - Mouse: ENSMUSG00000050272
• Gene ID - Rat: ENSRNOG00000027992
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.