Anti DSCAM pAb (ATL-HPA057493)

Atlas Antibodies

Catalog No.:
ATL-HPA057493-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DS cell adhesion molecule
Gene Name: DSCAM
Alternative Gene Name: CHD2-42, CHD2-52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050272: 97%, ENSRNOG00000027992: 97%
Entrez Gene ID: 1826
Uniprot ID: O60469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK
Gene Sequence QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK
Gene ID - Mouse ENSMUSG00000050272
Gene ID - Rat ENSRNOG00000027992
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DSCAM pAb (ATL-HPA057493)
Datasheet Anti DSCAM pAb (ATL-HPA057493) Datasheet (External Link)
Vendor Page Anti DSCAM pAb (ATL-HPA057493) at Atlas Antibodies

Documents & Links for Anti DSCAM pAb (ATL-HPA057493)
Datasheet Anti DSCAM pAb (ATL-HPA057493) Datasheet (External Link)
Vendor Page Anti DSCAM pAb (ATL-HPA057493)