Anti DSC3 pAb (ATL-HPA073937)

Atlas Antibodies

Catalog No.: ATL-HPA073937-25

Protein Description: desmocollin 3
Gene Name: DSC3
Alternative Gene Name: CDHF3, DSC, DSC1, DSC2, DSC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059898: 73%, ENSRNOG00000017159: 68%
Entrez Gene ID: 1825
Uniprot ID: Q14574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRET
• Gene Sequence: PDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRET
• Gene ID - Mouse: ENSMUSG00000059898
• Gene ID - Rat: ENSRNOG00000017159
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.