Anti DSC3 pAb (ATL-HPA073937)

Atlas Antibodies

Catalog No.:
ATL-HPA073937-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: desmocollin 3
Gene Name: DSC3
Alternative Gene Name: CDHF3, DSC, DSC1, DSC2, DSC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059898: 73%, ENSRNOG00000017159: 68%
Entrez Gene ID: 1825
Uniprot ID: Q14574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRET
Gene Sequence PDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRET
Gene ID - Mouse ENSMUSG00000059898
Gene ID - Rat ENSRNOG00000017159
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DSC3 pAb (ATL-HPA073937)
Datasheet Anti DSC3 pAb (ATL-HPA073937) Datasheet (External Link)
Vendor Page Anti DSC3 pAb (ATL-HPA073937) at Atlas Antibodies

Documents & Links for Anti DSC3 pAb (ATL-HPA073937)
Datasheet Anti DSC3 pAb (ATL-HPA073937) Datasheet (External Link)
Vendor Page Anti DSC3 pAb (ATL-HPA073937)