Anti DRGX pAb (ATL-HPA043978)

Atlas Antibodies

SKU:
ATL-HPA043978-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dorsal root ganglia homeobox
Gene Name: DRGX
Alternative Gene Name: DRG11, PRRXL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041730: 91%, ENSRNOG00000020045: 88%
Entrez Gene ID: 644168
Uniprot ID: A6NNA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV
Gene Sequence PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV
Gene ID - Mouse ENSMUSG00000041730
Gene ID - Rat ENSRNOG00000020045
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DRGX pAb (ATL-HPA043978)
Datasheet Anti DRGX pAb (ATL-HPA043978) Datasheet (External Link)
Vendor Page Anti DRGX pAb (ATL-HPA043978) at Atlas Antibodies

Documents & Links for Anti DRGX pAb (ATL-HPA043978)
Datasheet Anti DRGX pAb (ATL-HPA043978) Datasheet (External Link)
Vendor Page Anti DRGX pAb (ATL-HPA043978)