Anti DRGX pAb (ATL-HPA043978)
Atlas Antibodies
- SKU:
- ATL-HPA043978-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DRGX
Alternative Gene Name: DRG11, PRRXL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041730: 91%, ENSRNOG00000020045: 88%
Entrez Gene ID: 644168
Uniprot ID: A6NNA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV |
Gene Sequence | PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV |
Gene ID - Mouse | ENSMUSG00000041730 |
Gene ID - Rat | ENSRNOG00000020045 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DRGX pAb (ATL-HPA043978) | |
Datasheet | Anti DRGX pAb (ATL-HPA043978) Datasheet (External Link) |
Vendor Page | Anti DRGX pAb (ATL-HPA043978) at Atlas Antibodies |
Documents & Links for Anti DRGX pAb (ATL-HPA043978) | |
Datasheet | Anti DRGX pAb (ATL-HPA043978) Datasheet (External Link) |
Vendor Page | Anti DRGX pAb (ATL-HPA043978) |