Anti DRD1 pAb (ATL-HPA017304)

Atlas Antibodies

SKU:
ATL-HPA017304-25
  • Immunofluorescent staining of human cell line A549 shows localization to plasma membrane.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: dopamine receptor D1
Gene Name: DRD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021478: 89%, ENSRNOG00000023688: 90%
Entrez Gene ID: 1812
Uniprot ID: P21728
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP
Gene Sequence FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP
Gene ID - Mouse ENSMUSG00000021478
Gene ID - Rat ENSRNOG00000023688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DRD1 pAb (ATL-HPA017304)
Datasheet Anti DRD1 pAb (ATL-HPA017304) Datasheet (External Link)
Vendor Page Anti DRD1 pAb (ATL-HPA017304) at Atlas Antibodies

Documents & Links for Anti DRD1 pAb (ATL-HPA017304)
Datasheet Anti DRD1 pAb (ATL-HPA017304) Datasheet (External Link)
Vendor Page Anti DRD1 pAb (ATL-HPA017304)