Anti DRC3 pAb (ATL-HPA036041)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036041-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DRC3
Alternative Gene Name: CFAP134, DKFZP586M1120, LRRC48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056598: 75%, ENSRNOG00000021303: 74%
Entrez Gene ID: 83450
Uniprot ID: Q9H069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQ |
Gene Sequence | GVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQ |
Gene ID - Mouse | ENSMUSG00000056598 |
Gene ID - Rat | ENSRNOG00000021303 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DRC3 pAb (ATL-HPA036041) | |
Datasheet | Anti DRC3 pAb (ATL-HPA036041) Datasheet (External Link) |
Vendor Page | Anti DRC3 pAb (ATL-HPA036041) at Atlas Antibodies |
Documents & Links for Anti DRC3 pAb (ATL-HPA036041) | |
Datasheet | Anti DRC3 pAb (ATL-HPA036041) Datasheet (External Link) |
Vendor Page | Anti DRC3 pAb (ATL-HPA036041) |