Anti DRC3 pAb (ATL-HPA036041)

Atlas Antibodies

Catalog No.:
ATL-HPA036041-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dynein regulatory complex subunit 3
Gene Name: DRC3
Alternative Gene Name: CFAP134, DKFZP586M1120, LRRC48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056598: 75%, ENSRNOG00000021303: 74%
Entrez Gene ID: 83450
Uniprot ID: Q9H069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQ
Gene Sequence GVGELLETYKDKFVIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKMILECSADISELFDALMTLEMQLVEQ
Gene ID - Mouse ENSMUSG00000056598
Gene ID - Rat ENSRNOG00000021303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DRC3 pAb (ATL-HPA036041)
Datasheet Anti DRC3 pAb (ATL-HPA036041) Datasheet (External Link)
Vendor Page Anti DRC3 pAb (ATL-HPA036041) at Atlas Antibodies

Documents & Links for Anti DRC3 pAb (ATL-HPA036041)
Datasheet Anti DRC3 pAb (ATL-HPA036041) Datasheet (External Link)
Vendor Page Anti DRC3 pAb (ATL-HPA036041)