Anti DRAP1 pAb (ATL-HPA006790 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA006790-100
  • Immunohistochemical staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DRAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401939).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: DR1-associated protein 1 (negative cofactor 2 alpha)
Gene Name: DRAP1
Alternative Gene Name: NC2-alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024914: 95%, ENSRNOG00000020527: 96%
Entrez Gene ID: 10589
Uniprot ID: Q14919
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQ
Gene Sequence RIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQ
Gene ID - Mouse ENSMUSG00000024914
Gene ID - Rat ENSRNOG00000020527
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DRAP1 pAb (ATL-HPA006790 w/enhanced validation)
Datasheet Anti DRAP1 pAb (ATL-HPA006790 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DRAP1 pAb (ATL-HPA006790 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DRAP1 pAb (ATL-HPA006790 w/enhanced validation)
Datasheet Anti DRAP1 pAb (ATL-HPA006790 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DRAP1 pAb (ATL-HPA006790 w/enhanced validation)