Anti DPYSL3 pAb (ATL-HPA010948)

Atlas Antibodies

Catalog No.: ATL-HPA010948-25

Protein Description: dihydropyrimidinase-like 3
Gene Name: DPYSL3
Alternative Gene Name: CRMP4, DRP-3, ULIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024501: 97%, ENSRNOG00000018992: 97%
Entrez Gene ID: 1809
Uniprot ID: Q14195
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE
• Gene Sequence: IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE
• Gene ID - Mouse: ENSMUSG00000024501
• Gene ID - Rat: ENSRNOG00000018992
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DPYSL3 pAb (ATL-HPA010948) – 1 Found

Moreira, José M A; Cabezón, Teresa; Gromova, Irina; Gromov, Pavel; Timmermans-Wielenga, Vera; Machado, Isidro; Llombart-Bosch, Antonio; Kroman, Niels; Rank, Fritz; Celis, Julio E. Tissue proteomics of the human mammary gland: towards an abridged definition of the molecular phenotypes underlying epithelial normalcy. Molecular Oncology. 2010;4(6):539-61.