Anti DPYS pAb (ATL-HPA024785 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024785-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DPYS
Alternative Gene Name: DHPase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022304: 85%, ENSRNOG00000004298: 82%
Entrez Gene ID: 1807
Uniprot ID: Q14117
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAG |
Gene Sequence | TISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAG |
Gene ID - Mouse | ENSMUSG00000022304 |
Gene ID - Rat | ENSRNOG00000004298 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) | |
Datasheet | Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) | |
Datasheet | Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) |