Anti DPYS pAb (ATL-HPA024785 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024785-25
  • Immunohistochemistry analysis in human liver and pancreas tissues using Anti-DPYS antibody. Corresponding DPYS RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DPYS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419991).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dihydropyrimidinase
Gene Name: DPYS
Alternative Gene Name: DHPase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022304: 85%, ENSRNOG00000004298: 82%
Entrez Gene ID: 1807
Uniprot ID: Q14117
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAG
Gene Sequence TISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAG
Gene ID - Mouse ENSMUSG00000022304
Gene ID - Rat ENSRNOG00000004298
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPYS pAb (ATL-HPA024785 w/enhanced validation)
Datasheet Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DPYS pAb (ATL-HPA024785 w/enhanced validation)
Datasheet Anti DPYS pAb (ATL-HPA024785 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DPYS pAb (ATL-HPA024785 w/enhanced validation)