Anti DPY19L4 pAb (ATL-HPA024780)
Atlas Antibodies
- SKU:
- ATL-HPA024780-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DPY19L4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045205: 96%, ENSRNOG00000025416: 96%
Entrez Gene ID: 286148
Uniprot ID: Q7Z388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTHNNKTVSLKTINAVQQMSLYPELIASILYQATG |
Gene Sequence | ELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTHNNKTVSLKTINAVQQMSLYPELIASILYQATG |
Gene ID - Mouse | ENSMUSG00000045205 |
Gene ID - Rat | ENSRNOG00000025416 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPY19L4 pAb (ATL-HPA024780) | |
Datasheet | Anti DPY19L4 pAb (ATL-HPA024780) Datasheet (External Link) |
Vendor Page | Anti DPY19L4 pAb (ATL-HPA024780) at Atlas Antibodies |
Documents & Links for Anti DPY19L4 pAb (ATL-HPA024780) | |
Datasheet | Anti DPY19L4 pAb (ATL-HPA024780) Datasheet (External Link) |
Vendor Page | Anti DPY19L4 pAb (ATL-HPA024780) |