Anti DPY19L4 pAb (ATL-HPA024780)

Atlas Antibodies

Catalog No.:
ATL-HPA024780-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dpy-19-like 4 (C. elegans)
Gene Name: DPY19L4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045205: 96%, ENSRNOG00000025416: 96%
Entrez Gene ID: 286148
Uniprot ID: Q7Z388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTHNNKTVSLKTINAVQQMSLYPELIASILYQATG
Gene Sequence ELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTHNNKTVSLKTINAVQQMSLYPELIASILYQATG
Gene ID - Mouse ENSMUSG00000045205
Gene ID - Rat ENSRNOG00000025416
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPY19L4 pAb (ATL-HPA024780)
Datasheet Anti DPY19L4 pAb (ATL-HPA024780) Datasheet (External Link)
Vendor Page Anti DPY19L4 pAb (ATL-HPA024780) at Atlas Antibodies

Documents & Links for Anti DPY19L4 pAb (ATL-HPA024780)
Datasheet Anti DPY19L4 pAb (ATL-HPA024780) Datasheet (External Link)
Vendor Page Anti DPY19L4 pAb (ATL-HPA024780)