Anti DPY19L3 pAb (ATL-HPA008325)

Atlas Antibodies

SKU:
ATL-HPA008325-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dpy-19-like 3 (C. elegans)
Gene Name: DPY19L3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043671: 93%, ENSRNOG00000021573: 93%
Entrez Gene ID: 147991
Uniprot ID: Q6ZPD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTVELMNWINSNTPRKAVFAGSMQLLAGVKLCTGRTLTNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICYERRHRRGCRLRDLLDIANGHMMDGPGENDPDLKPADHPRFCEEIKRNLP
Gene Sequence DTVELMNWINSNTPRKAVFAGSMQLLAGVKLCTGRTLTNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICYERRHRRGCRLRDLLDIANGHMMDGPGENDPDLKPADHPRFCEEIKRNLP
Gene ID - Mouse ENSMUSG00000043671
Gene ID - Rat ENSRNOG00000021573
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPY19L3 pAb (ATL-HPA008325)
Datasheet Anti DPY19L3 pAb (ATL-HPA008325) Datasheet (External Link)
Vendor Page Anti DPY19L3 pAb (ATL-HPA008325) at Atlas Antibodies

Documents & Links for Anti DPY19L3 pAb (ATL-HPA008325)
Datasheet Anti DPY19L3 pAb (ATL-HPA008325) Datasheet (External Link)
Vendor Page Anti DPY19L3 pAb (ATL-HPA008325)