Anti DPY19L2 pAb (ATL-HPA071264)

Atlas Antibodies

Catalog No.:
ATL-HPA071264-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: dpy-19-like 2 (C. elegans)
Gene Name: DPY19L2
Alternative Gene Name: FLJ32949, SPATA34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063952: 37%, ENSRNOG00000028641: 37%
Entrez Gene ID: 283417
Uniprot ID: Q6NUT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQGVSSKRLQSSGCSQSKGRRGASLAREPEVEEEM
Gene Sequence KQGVSSKRLQSSGCSQSKGRRGASLAREPEVEEEM
Gene ID - Mouse ENSMUSG00000063952
Gene ID - Rat ENSRNOG00000028641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPY19L2 pAb (ATL-HPA071264)
Datasheet Anti DPY19L2 pAb (ATL-HPA071264) Datasheet (External Link)
Vendor Page Anti DPY19L2 pAb (ATL-HPA071264) at Atlas Antibodies

Documents & Links for Anti DPY19L2 pAb (ATL-HPA071264)
Datasheet Anti DPY19L2 pAb (ATL-HPA071264) Datasheet (External Link)
Vendor Page Anti DPY19L2 pAb (ATL-HPA071264)