Anti DPT pAb (ATL-HPA065548)

Atlas Antibodies

Catalog No.:
ATL-HPA065548-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: dermatopontin
Gene Name: DPT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026574: 91%, ENSRNOG00000002947: 94%
Entrez Gene ID: 1805
Uniprot ID: Q07507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP
Gene Sequence GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP
Gene ID - Mouse ENSMUSG00000026574
Gene ID - Rat ENSRNOG00000002947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPT pAb (ATL-HPA065548)
Datasheet Anti DPT pAb (ATL-HPA065548) Datasheet (External Link)
Vendor Page Anti DPT pAb (ATL-HPA065548) at Atlas Antibodies

Documents & Links for Anti DPT pAb (ATL-HPA065548)
Datasheet Anti DPT pAb (ATL-HPA065548) Datasheet (External Link)
Vendor Page Anti DPT pAb (ATL-HPA065548)