Anti DPT pAb (ATL-HPA065548)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065548-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DPT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026574: 91%, ENSRNOG00000002947: 94%
Entrez Gene ID: 1805
Uniprot ID: Q07507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP |
Gene Sequence | GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP |
Gene ID - Mouse | ENSMUSG00000026574 |
Gene ID - Rat | ENSRNOG00000002947 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPT pAb (ATL-HPA065548) | |
Datasheet | Anti DPT pAb (ATL-HPA065548) Datasheet (External Link) |
Vendor Page | Anti DPT pAb (ATL-HPA065548) at Atlas Antibodies |
Documents & Links for Anti DPT pAb (ATL-HPA065548) | |
Datasheet | Anti DPT pAb (ATL-HPA065548) Datasheet (External Link) |
Vendor Page | Anti DPT pAb (ATL-HPA065548) |