Anti DPPA5 pAb (ATL-HPA064505)

Atlas Antibodies

SKU:
ATL-HPA064505-25
  • Immunohistochemical staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: developmental pluripotency associated 5
Gene Name: DPPA5
Alternative Gene Name: Esg1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060461: 73%, ENSRNOG00000060610: 75%
Entrez Gene ID: 340168
Uniprot ID: A6NC42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS
Gene Sequence MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS
Gene ID - Mouse ENSMUSG00000060461
Gene ID - Rat ENSRNOG00000060610
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPPA5 pAb (ATL-HPA064505)
Datasheet Anti DPPA5 pAb (ATL-HPA064505) Datasheet (External Link)
Vendor Page Anti DPPA5 pAb (ATL-HPA064505) at Atlas Antibodies

Documents & Links for Anti DPPA5 pAb (ATL-HPA064505)
Datasheet Anti DPPA5 pAb (ATL-HPA064505) Datasheet (External Link)
Vendor Page Anti DPPA5 pAb (ATL-HPA064505)