Anti DPPA5 pAb (ATL-HPA055016)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055016-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DPPA5
Alternative Gene Name: Esg1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060461: 73%, ENSRNOG00000000199: 75%
Entrez Gene ID: 340168
Uniprot ID: A6NC42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS |
Gene Sequence | MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS |
Gene ID - Mouse | ENSMUSG00000060461 |
Gene ID - Rat | ENSRNOG00000000199 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPPA5 pAb (ATL-HPA055016) | |
Datasheet | Anti DPPA5 pAb (ATL-HPA055016) Datasheet (External Link) |
Vendor Page | Anti DPPA5 pAb (ATL-HPA055016) at Atlas Antibodies |
Documents & Links for Anti DPPA5 pAb (ATL-HPA055016) | |
Datasheet | Anti DPPA5 pAb (ATL-HPA055016) Datasheet (External Link) |
Vendor Page | Anti DPPA5 pAb (ATL-HPA055016) |