Anti DPPA4 pAb (ATL-HPA035249)

Atlas Antibodies

SKU:
ATL-HPA035249-25
  • Immunohistochemical staining of human testis shows nuclear positivity in seminiferous ducts.
  • Immunofluorescent staining of human cell line AF22 shows localization to nucleus, nucleoli & plasma membrane.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line NTERA-2
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: developmental pluripotency associated 4
Gene Name: DPPA4
Alternative Gene Name: FLJ10713
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058550: 39%, ENSRNOG00000025404: 33%
Entrez Gene ID: 55211
Uniprot ID: Q7L190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRD
Gene Sequence ASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRD
Gene ID - Mouse ENSMUSG00000058550
Gene ID - Rat ENSRNOG00000025404
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPPA4 pAb (ATL-HPA035249)
Datasheet Anti DPPA4 pAb (ATL-HPA035249) Datasheet (External Link)
Vendor Page Anti DPPA4 pAb (ATL-HPA035249) at Atlas Antibodies

Documents & Links for Anti DPPA4 pAb (ATL-HPA035249)
Datasheet Anti DPPA4 pAb (ATL-HPA035249) Datasheet (External Link)
Vendor Page Anti DPPA4 pAb (ATL-HPA035249)