Anti DPPA4 pAb (ATL-HPA035249)

Atlas Antibodies

Catalog No.:
ATL-HPA035249-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: developmental pluripotency associated 4
Gene Name: DPPA4
Alternative Gene Name: FLJ10713
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058550: 39%, ENSRNOG00000025404: 33%
Entrez Gene ID: 55211
Uniprot ID: Q7L190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRD
Gene Sequence ASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRD
Gene ID - Mouse ENSMUSG00000058550
Gene ID - Rat ENSRNOG00000025404
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPPA4 pAb (ATL-HPA035249)
Datasheet Anti DPPA4 pAb (ATL-HPA035249) Datasheet (External Link)
Vendor Page Anti DPPA4 pAb (ATL-HPA035249) at Atlas Antibodies

Documents & Links for Anti DPPA4 pAb (ATL-HPA035249)
Datasheet Anti DPPA4 pAb (ATL-HPA035249) Datasheet (External Link)
Vendor Page Anti DPPA4 pAb (ATL-HPA035249)