Anti DPP8 pAb (ATL-HPA008706)
Atlas Antibodies
- SKU:
- ATL-HPA008706-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DPP8
Alternative Gene Name: DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032393: 96%, ENSRNOG00000019105: 95%
Entrez Gene ID: 54878
Uniprot ID: Q6V1X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPL |
Gene Sequence | MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPL |
Gene ID - Mouse | ENSMUSG00000032393 |
Gene ID - Rat | ENSRNOG00000019105 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPP8 pAb (ATL-HPA008706) | |
Datasheet | Anti DPP8 pAb (ATL-HPA008706) Datasheet (External Link) |
Vendor Page | Anti DPP8 pAb (ATL-HPA008706) at Atlas Antibodies |
Documents & Links for Anti DPP8 pAb (ATL-HPA008706) | |
Datasheet | Anti DPP8 pAb (ATL-HPA008706) Datasheet (External Link) |
Vendor Page | Anti DPP8 pAb (ATL-HPA008706) |