Anti DPP8 pAb (ATL-HPA008706)

Atlas Antibodies

Catalog No.: ATL-HPA008706-25

Protein Description: dipeptidyl-peptidase 8
Gene Name: DPP8
Alternative Gene Name: DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032393: 96%, ENSRNOG00000019105: 95%
Entrez Gene ID: 54878
Uniprot ID: Q6V1X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPL
• Gene Sequence: MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPL
• Gene ID - Mouse: ENSMUSG00000032393
• Gene ID - Rat: ENSRNOG00000019105
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.