Anti DPP8 pAb (ATL-HPA008706)

Atlas Antibodies

SKU:
ATL-HPA008706-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dipeptidyl-peptidase 8
Gene Name: DPP8
Alternative Gene Name: DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032393: 96%, ENSRNOG00000019105: 95%
Entrez Gene ID: 54878
Uniprot ID: Q6V1X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPL
Gene Sequence MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPL
Gene ID - Mouse ENSMUSG00000032393
Gene ID - Rat ENSRNOG00000019105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPP8 pAb (ATL-HPA008706)
Datasheet Anti DPP8 pAb (ATL-HPA008706) Datasheet (External Link)
Vendor Page Anti DPP8 pAb (ATL-HPA008706) at Atlas Antibodies

Documents & Links for Anti DPP8 pAb (ATL-HPA008706)
Datasheet Anti DPP8 pAb (ATL-HPA008706) Datasheet (External Link)
Vendor Page Anti DPP8 pAb (ATL-HPA008706)