Anti DPP7 pAb (ATL-HPA021282)

Atlas Antibodies

Catalog No.:
ATL-HPA021282-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: dipeptidyl-peptidase 7
Gene Name: DPP7
Alternative Gene Name: DPPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026958: 87%, ENSRNOG00000012640: 83%
Entrez Gene ID: 29952
Uniprot ID: Q9UHL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLYH
Gene Sequence MFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLYH
Gene ID - Mouse ENSMUSG00000026958
Gene ID - Rat ENSRNOG00000012640
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPP7 pAb (ATL-HPA021282)
Datasheet Anti DPP7 pAb (ATL-HPA021282) Datasheet (External Link)
Vendor Page Anti DPP7 pAb (ATL-HPA021282) at Atlas Antibodies

Documents & Links for Anti DPP7 pAb (ATL-HPA021282)
Datasheet Anti DPP7 pAb (ATL-HPA021282) Datasheet (External Link)
Vendor Page Anti DPP7 pAb (ATL-HPA021282)