Anti DPP6 pAb (ATL-HPA050509)

Atlas Antibodies

Catalog No.:
ATL-HPA050509-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: dipeptidyl-peptidase 6
Gene Name: DPP6
Alternative Gene Name: DPPX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061576: 86%, ENSRNOG00000030547: 86%
Entrez Gene ID: 1804
Uniprot ID: P42658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
Gene Sequence VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
Gene ID - Mouse ENSMUSG00000061576
Gene ID - Rat ENSRNOG00000030547
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPP6 pAb (ATL-HPA050509)
Datasheet Anti DPP6 pAb (ATL-HPA050509) Datasheet (External Link)
Vendor Page Anti DPP6 pAb (ATL-HPA050509) at Atlas Antibodies

Documents & Links for Anti DPP6 pAb (ATL-HPA050509)
Datasheet Anti DPP6 pAb (ATL-HPA050509) Datasheet (External Link)
Vendor Page Anti DPP6 pAb (ATL-HPA050509)