Anti DPP4 pAb (ATL-HPA068778)

Atlas Antibodies

Catalog No.:
ATL-HPA068778-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: dipeptidyl peptidase 4
Gene Name: DPP4
Alternative Gene Name: ADCP2, CD26, DPPIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035000: 83%, ENSRNOG00000030763: 83%
Entrez Gene ID: 1803
Uniprot ID: P27487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP
Gene Sequence MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP
Gene ID - Mouse ENSMUSG00000035000
Gene ID - Rat ENSRNOG00000030763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPP4 pAb (ATL-HPA068778)
Datasheet Anti DPP4 pAb (ATL-HPA068778) Datasheet (External Link)
Vendor Page Anti DPP4 pAb (ATL-HPA068778) at Atlas Antibodies

Documents & Links for Anti DPP4 pAb (ATL-HPA068778)
Datasheet Anti DPP4 pAb (ATL-HPA068778) Datasheet (External Link)
Vendor Page Anti DPP4 pAb (ATL-HPA068778)