Anti DPP4 pAb (ATL-HPA068778)

Atlas Antibodies

Catalog No.: ATL-HPA068778-25

Protein Description: dipeptidyl peptidase 4
Gene Name: DPP4
Alternative Gene Name: ADCP2, CD26, DPPIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035000: 83%, ENSRNOG00000030763: 83%
Entrez Gene ID: 1803
Uniprot ID: P27487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP
• Gene Sequence: MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP
• Gene ID - Mouse: ENSMUSG00000035000
• Gene ID - Rat: ENSRNOG00000030763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.