Anti DPP3 pAb (ATL-HPA035781 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035781-25
  • Immunohistochemical staining of human vulva/anal skin shows strong cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles, plasma membrane & cytosol.
  • Western blot analysis using Anti-DPP3 antibody HPA035781 (A) shows similar pattern to independent antibody HPA035780 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dipeptidyl-peptidase 3
Gene Name: DPP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063904: 84%, ENSRNOG00000031485: 85%
Entrez Gene ID: 10072
Uniprot ID: Q9NY33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSH
Gene Sequence YFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSH
Gene ID - Mouse ENSMUSG00000063904
Gene ID - Rat ENSRNOG00000031485
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPP3 pAb (ATL-HPA035781 w/enhanced validation)
Datasheet Anti DPP3 pAb (ATL-HPA035781 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DPP3 pAb (ATL-HPA035781 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DPP3 pAb (ATL-HPA035781 w/enhanced validation)
Datasheet Anti DPP3 pAb (ATL-HPA035781 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DPP3 pAb (ATL-HPA035781 w/enhanced validation)