Anti DPP3 pAb (ATL-HPA035781 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035781-25

Protein Description: dipeptidyl-peptidase 3
Gene Name: DPP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063904: 84%, ENSRNOG00000031485: 85%
Entrez Gene ID: 10072
Uniprot ID: Q9NY33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSH
• Gene Sequence: YFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSH
• Gene ID - Mouse: ENSMUSG00000063904
• Gene ID - Rat: ENSRNOG00000031485
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.