Anti DPH7 pAb (ATL-HPA022911)

Atlas Antibodies

Catalog No.: ATL-HPA022911-25

Protein Description: diphthamide biosynthesis 7
Gene Name: DPH7
Alternative Gene Name: C9orf112, FLJ90634, RRT2, WDR85
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091002: 24%, ENSRNOG00000008102: 34%
Entrez Gene ID: 92715
Uniprot ID: Q9BTV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA
• Gene Sequence: WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA
• Gene ID - Mouse: ENSMUSG00000091002
• Gene ID - Rat: ENSRNOG00000008102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DPH7 pAb (ATL-HPA022911) – 2 Found

Naamati, Adi; Williamson, James C; Greenwood, Edward Jd; Marelli, Sara; Lehner, Paul J; Matheson, Nicholas J. Functional proteomic atlas of HIV infection in primary human CD4+ T cells. Elife. 2019;8( 30857592) 

Marelli, Sara; Williamson, James C; Protasio, Anna V; Naamati, Adi; Greenwood, Edward Jd; Deane, Janet E; Lehner, Paul J; Matheson, Nicholas J. Antagonism of PP2A is an independent and conserved function of HIV-1 Vif and causes cell cycle arrest. Elife. 2020;9( 32292164)