Anti DPH7 pAb (ATL-HPA022911)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022911-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DPH7
Alternative Gene Name: C9orf112, FLJ90634, RRT2, WDR85
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091002: 24%, ENSRNOG00000008102: 34%
Entrez Gene ID: 92715
Uniprot ID: Q9BTV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA |
| Gene Sequence | WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA |
| Gene ID - Mouse | ENSMUSG00000091002 |
| Gene ID - Rat | ENSRNOG00000008102 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DPH7 pAb (ATL-HPA022911) | |
| Datasheet | Anti DPH7 pAb (ATL-HPA022911) Datasheet (External Link) |
| Vendor Page | Anti DPH7 pAb (ATL-HPA022911) at Atlas Antibodies |
| Documents & Links for Anti DPH7 pAb (ATL-HPA022911) | |
| Datasheet | Anti DPH7 pAb (ATL-HPA022911) Datasheet (External Link) |
| Vendor Page | Anti DPH7 pAb (ATL-HPA022911) |
| Citations for Anti DPH7 pAb (ATL-HPA022911) – 2 Found |
| Naamati, Adi; Williamson, James C; Greenwood, Edward Jd; Marelli, Sara; Lehner, Paul J; Matheson, Nicholas J. Functional proteomic atlas of HIV infection in primary human CD4+ T cells. Elife. 2019;8( 30857592) PubMed |
| Marelli, Sara; Williamson, James C; Protasio, Anna V; Naamati, Adi; Greenwood, Edward Jd; Deane, Janet E; Lehner, Paul J; Matheson, Nicholas J. Antagonism of PP2A is an independent and conserved function of HIV-1 Vif and causes cell cycle arrest. Elife. 2020;9( 32292164) PubMed |