Anti DPH6 pAb (ATL-HPA042976)

Atlas Antibodies

Catalog No.:
ATL-HPA042976-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: diphthamine biosynthesis 6
Gene Name: DPH6
Alternative Gene Name: ATPBD4, MGC14798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057147: 90%, ENSRNOG00000037356: 89%
Entrez Gene ID: 89978
Uniprot ID: Q7L8W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCE
Gene Sequence ISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCE
Gene ID - Mouse ENSMUSG00000057147
Gene ID - Rat ENSRNOG00000037356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPH6 pAb (ATL-HPA042976)
Datasheet Anti DPH6 pAb (ATL-HPA042976) Datasheet (External Link)
Vendor Page Anti DPH6 pAb (ATL-HPA042976) at Atlas Antibodies

Documents & Links for Anti DPH6 pAb (ATL-HPA042976)
Datasheet Anti DPH6 pAb (ATL-HPA042976) Datasheet (External Link)
Vendor Page Anti DPH6 pAb (ATL-HPA042976)