Anti DPH5 pAb (ATL-HPA076234)

Atlas Antibodies

Catalog No.:
ATL-HPA076234-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: diphthamide biosynthesis 5
Gene Name: DPH5
Alternative Gene Name: CGI-30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033554: 94%, ENSRNOG00000013719: 95%
Entrez Gene ID: 51611
Uniprot ID: Q9H2P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS
Gene Sequence VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS
Gene ID - Mouse ENSMUSG00000033554
Gene ID - Rat ENSRNOG00000013719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPH5 pAb (ATL-HPA076234)
Datasheet Anti DPH5 pAb (ATL-HPA076234) Datasheet (External Link)
Vendor Page Anti DPH5 pAb (ATL-HPA076234) at Atlas Antibodies

Documents & Links for Anti DPH5 pAb (ATL-HPA076234)
Datasheet Anti DPH5 pAb (ATL-HPA076234) Datasheet (External Link)
Vendor Page Anti DPH5 pAb (ATL-HPA076234)