Anti DPH3 pAb (ATL-HPA035287)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035287-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DPH3
Alternative Gene Name: DELGIP, DELGIP1, DESR1, DPH3A, KTI11, MGC20197, ZCSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021905: 96%, ENSRNOG00000019727: 94%
Entrez Gene ID: 285381
Uniprot ID: Q96FX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK |
Gene Sequence | EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK |
Gene ID - Mouse | ENSMUSG00000021905 |
Gene ID - Rat | ENSRNOG00000019727 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPH3 pAb (ATL-HPA035287) | |
Datasheet | Anti DPH3 pAb (ATL-HPA035287) Datasheet (External Link) |
Vendor Page | Anti DPH3 pAb (ATL-HPA035287) at Atlas Antibodies |
Documents & Links for Anti DPH3 pAb (ATL-HPA035287) | |
Datasheet | Anti DPH3 pAb (ATL-HPA035287) Datasheet (External Link) |
Vendor Page | Anti DPH3 pAb (ATL-HPA035287) |