Anti DPH3 pAb (ATL-HPA035287)

Atlas Antibodies

Catalog No.: ATL-HPA035287-25

Protein Description: diphthamide biosynthesis 3
Gene Name: DPH3
Alternative Gene Name: DELGIP, DELGIP1, DESR1, DPH3A, KTI11, MGC20197, ZCSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021905: 96%, ENSRNOG00000019727: 94%
Entrez Gene ID: 285381
Uniprot ID: Q96FX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK
• Gene Sequence: EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK
• Gene ID - Mouse: ENSMUSG00000021905
• Gene ID - Rat: ENSRNOG00000019727
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.