Anti DPH3 pAb (ATL-HPA035287)

Atlas Antibodies

Catalog No.:
ATL-HPA035287-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: diphthamide biosynthesis 3
Gene Name: DPH3
Alternative Gene Name: DELGIP, DELGIP1, DESR1, DPH3A, KTI11, MGC20197, ZCSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021905: 96%, ENSRNOG00000019727: 94%
Entrez Gene ID: 285381
Uniprot ID: Q96FX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK
Gene Sequence EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK
Gene ID - Mouse ENSMUSG00000021905
Gene ID - Rat ENSRNOG00000019727
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPH3 pAb (ATL-HPA035287)
Datasheet Anti DPH3 pAb (ATL-HPA035287) Datasheet (External Link)
Vendor Page Anti DPH3 pAb (ATL-HPA035287) at Atlas Antibodies

Documents & Links for Anti DPH3 pAb (ATL-HPA035287)
Datasheet Anti DPH3 pAb (ATL-HPA035287) Datasheet (External Link)
Vendor Page Anti DPH3 pAb (ATL-HPA035287)