Anti DPH2 pAb (ATL-HPA045796)

Atlas Antibodies

Catalog No.:
ATL-HPA045796-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DPH2 homolog (S. cerevisiae)
Gene Name: DPH2
Alternative Gene Name: DPH2L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028540: 77%, ENSRNOG00000019735: 81%
Entrez Gene ID: 1802
Uniprot ID: Q9BQC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRL
Gene Sequence DPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRL
Gene ID - Mouse ENSMUSG00000028540
Gene ID - Rat ENSRNOG00000019735
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPH2 pAb (ATL-HPA045796)
Datasheet Anti DPH2 pAb (ATL-HPA045796) Datasheet (External Link)
Vendor Page Anti DPH2 pAb (ATL-HPA045796) at Atlas Antibodies

Documents & Links for Anti DPH2 pAb (ATL-HPA045796)
Datasheet Anti DPH2 pAb (ATL-HPA045796) Datasheet (External Link)
Vendor Page Anti DPH2 pAb (ATL-HPA045796)