Anti DPH1 pAb (ATL-HPA069750)

Atlas Antibodies

Catalog No.:
ATL-HPA069750-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: diphthamide biosynthesis 1
Gene Name: DPH1
Alternative Gene Name: DPH2L, DPH2L1, OVCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078789: 92%, ENSRNOG00000003116: 92%
Entrez Gene ID: 1801
Uniprot ID: Q9BZG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK
Gene Sequence EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK
Gene ID - Mouse ENSMUSG00000078789
Gene ID - Rat ENSRNOG00000003116
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPH1 pAb (ATL-HPA069750)
Datasheet Anti DPH1 pAb (ATL-HPA069750) Datasheet (External Link)
Vendor Page Anti DPH1 pAb (ATL-HPA069750) at Atlas Antibodies

Documents & Links for Anti DPH1 pAb (ATL-HPA069750)
Datasheet Anti DPH1 pAb (ATL-HPA069750) Datasheet (External Link)
Vendor Page Anti DPH1 pAb (ATL-HPA069750)