Anti DPF2 pAb (ATL-HPA056786)

Atlas Antibodies

Catalog No.:
ATL-HPA056786-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: D4, zinc and double PHD fingers family 2
Gene Name: DPF2
Alternative Gene Name: BAF45d, REQ, ubi-d4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024826: 97%, ENSRNOG00000020892: 100%
Entrez Gene ID: 5977
Uniprot ID: Q92785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY
Gene Sequence AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY
Gene ID - Mouse ENSMUSG00000024826
Gene ID - Rat ENSRNOG00000020892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPF2 pAb (ATL-HPA056786)
Datasheet Anti DPF2 pAb (ATL-HPA056786) Datasheet (External Link)
Vendor Page Anti DPF2 pAb (ATL-HPA056786) at Atlas Antibodies

Documents & Links for Anti DPF2 pAb (ATL-HPA056786)
Datasheet Anti DPF2 pAb (ATL-HPA056786) Datasheet (External Link)
Vendor Page Anti DPF2 pAb (ATL-HPA056786)