Anti DPF2 pAb (ATL-HPA056786)

Atlas Antibodies

Catalog No.: ATL-HPA056786-100

Protein Description: D4, zinc and double PHD fingers family 2
Gene Name: DPF2
Alternative Gene Name: BAF45d, REQ, ubi-d4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024826: 97%, ENSRNOG00000020892: 100%
Entrez Gene ID: 5977
Uniprot ID: Q92785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY
• Gene Sequence: AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY
• Gene ID - Mouse: ENSMUSG00000024826
• Gene ID - Rat: ENSRNOG00000020892
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.