Anti DPF2 pAb (ATL-HPA020880)

Atlas Antibodies

SKU:
ATL-HPA020880-100
  • Immunohistochemical staining of human salivary gland shows weak cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in human cell line TD47D and human cell line THP-1.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: D4, zinc and double PHD fingers family 2
Gene Name: DPF2
Alternative Gene Name: BAF45d, REQ, ubi-d4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024826: 96%, ENSRNOG00000020892: 98%
Entrez Gene ID: 5977
Uniprot ID: Q92785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGS
Gene Sequence SFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGS
Gene ID - Mouse ENSMUSG00000024826
Gene ID - Rat ENSRNOG00000020892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPF2 pAb (ATL-HPA020880)
Datasheet Anti DPF2 pAb (ATL-HPA020880) Datasheet (External Link)
Vendor Page Anti DPF2 pAb (ATL-HPA020880) at Atlas Antibodies

Documents & Links for Anti DPF2 pAb (ATL-HPA020880)
Datasheet Anti DPF2 pAb (ATL-HPA020880) Datasheet (External Link)
Vendor Page Anti DPF2 pAb (ATL-HPA020880)



Citations for Anti DPF2 pAb (ATL-HPA020880) – 1 Found
Cruickshank, V Adam; Sroczynska, Patrycja; Sankar, Aditya; Miyagi, Satoru; Rundsten, Carsten Friis; Johansen, Jens Vilstrup; Helin, Kristian. SWI/SNF Subunits SMARCA4, SMARCD2 and DPF2 Collaborate in MLL-Rearranged Leukaemia Maintenance. Plos One. 10(11):e0142806.  PubMed