Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA058607-25

Protein Description: dipeptidase 3
Gene Name: DPEP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031898: 55%, ENSRNOG00000019757: 56%
Entrez Gene ID: 64180
Uniprot ID: Q9H4B8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRV
• Gene Sequence: KVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRV
• Gene ID - Mouse: ENSMUSG00000031898
• Gene ID - Rat: ENSRNOG00000019757
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation) – 2 Found

Schiza, Christina; Korbakis, Dimitrios; Panteleli, Efstratia; Jarvi, Keith; Drabovich, Andrei P; Diamandis, Eleftherios P. Discovery of a Human Testis-specific Protein Complex TEX101-DPEP3 and Selection of Its Disrupting Antibodies. Molecular & Cellular Proteomics : Mcp. 2018;17(12):2480-2495. 

Schiza, Christina; Korbakis, Dimitrios; Jarvi, Keith; Diamandis, Eleftherios P; Drabovich, Andrei P. Identification of TEX101-associated Proteins Through Proteomic Measurement of Human Spermatozoa Homozygous for the Missense Variant rs35033974. Molecular & Cellular Proteomics : Mcp. 2019;18(2):338-351.