Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058607-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DPEP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031898: 55%, ENSRNOG00000019757: 56%
Entrez Gene ID: 64180
Uniprot ID: Q9H4B8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRV |
| Gene Sequence | KVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRV |
| Gene ID - Mouse | ENSMUSG00000031898 |
| Gene ID - Rat | ENSRNOG00000019757 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation) | |
| Datasheet | Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation) | |
| Datasheet | Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation) |
| Citations for Anti DPEP3 pAb (ATL-HPA058607 w/enhanced validation) – 2 Found |
| Schiza, Christina; Korbakis, Dimitrios; Panteleli, Efstratia; Jarvi, Keith; Drabovich, Andrei P; Diamandis, Eleftherios P. Discovery of a Human Testis-specific Protein Complex TEX101-DPEP3 and Selection of Its Disrupting Antibodies. Molecular & Cellular Proteomics : Mcp. 2018;17(12):2480-2495. PubMed |
| Schiza, Christina; Korbakis, Dimitrios; Jarvi, Keith; Diamandis, Eleftherios P; Drabovich, Andrei P. Identification of TEX101-associated Proteins Through Proteomic Measurement of Human Spermatozoa Homozygous for the Missense Variant rs35033974. Molecular & Cellular Proteomics : Mcp. 2019;18(2):338-351. PubMed |