Anti DPEP2 pAb (ATL-HPA035644)

Atlas Antibodies

SKU:
ATL-HPA035644-25
  • Immunohistochemical staining of human spleen shows strong cytoplasmic and membranous positivity in subset of cells in red pulp and sinusoids.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dipeptidase 2
Gene Name: DPEP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053687: 32%, ENSRNOG00000023303: 46%
Entrez Gene ID: 64174
Uniprot ID: Q9H4A9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSV
Gene Sequence NKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSV
Gene ID - Mouse ENSMUSG00000053687
Gene ID - Rat ENSRNOG00000023303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DPEP2 pAb (ATL-HPA035644)
Datasheet Anti DPEP2 pAb (ATL-HPA035644) Datasheet (External Link)
Vendor Page Anti DPEP2 pAb (ATL-HPA035644) at Atlas Antibodies

Documents & Links for Anti DPEP2 pAb (ATL-HPA035644)
Datasheet Anti DPEP2 pAb (ATL-HPA035644) Datasheet (External Link)
Vendor Page Anti DPEP2 pAb (ATL-HPA035644)