Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012783-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: dipeptidase 1 (renal)
Gene Name: DPEP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019278: 80%, ENSRNOG00000015880: 82%
Entrez Gene ID: 1800
Uniprot ID: P16444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRN
Gene Sequence SLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRN
Gene ID - Mouse ENSMUSG00000019278
Gene ID - Rat ENSRNOG00000015880
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation)
Datasheet Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation)
Datasheet Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation)
Citations for Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) – 2 Found
Okamoto, Takako; Matsumura, Noriomi; Mandai, Masaki; Oura, Tomonori; Yamanishi, Yukio; Horiuchi, Akiko; Hamanishi, Junzo; Baba, Tsukasa; Koshiyama, Masafumi; Shiozawa, Tanri; Konishi, Ikuo. Distinguishing primary from secondary mucinous ovarian tumors: an algorithm using the novel marker DPEP1. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2011;24(2):267-76.  PubMed
Tachibana, Kazunoshin; Saito, Motonobu; Imai, Jun-Ichi; Ito, Emi; Yanagisawa, Yuka; Honma, Reiko; Saito, Katsuharu; Ando, Jin; Momma, Tomoyuki; Ohki, Shinji; Ohtake, Tohru; Watanabe, Shinya; Waguri, Satoshi; Takenoshita, Seiichi. Clinicopathological examination of dipeptidase 1 expression in colorectal cancer. Biomedical Reports. 2017;6(4):423-428.  PubMed