Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012783-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DPEP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019278: 80%, ENSRNOG00000015880: 82%
Entrez Gene ID: 1800
Uniprot ID: P16444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRN |
Gene Sequence | SLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRN |
Gene ID - Mouse | ENSMUSG00000019278 |
Gene ID - Rat | ENSRNOG00000015880 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) | |
Datasheet | Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) | |
Datasheet | Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) |
Citations for Anti DPEP1 pAb (ATL-HPA012783 w/enhanced validation) – 2 Found |
Okamoto, Takako; Matsumura, Noriomi; Mandai, Masaki; Oura, Tomonori; Yamanishi, Yukio; Horiuchi, Akiko; Hamanishi, Junzo; Baba, Tsukasa; Koshiyama, Masafumi; Shiozawa, Tanri; Konishi, Ikuo. Distinguishing primary from secondary mucinous ovarian tumors: an algorithm using the novel marker DPEP1. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2011;24(2):267-76. PubMed |
Tachibana, Kazunoshin; Saito, Motonobu; Imai, Jun-Ichi; Ito, Emi; Yanagisawa, Yuka; Honma, Reiko; Saito, Katsuharu; Ando, Jin; Momma, Tomoyuki; Ohki, Shinji; Ohtake, Tohru; Watanabe, Shinya; Waguri, Satoshi; Takenoshita, Seiichi. Clinicopathological examination of dipeptidase 1 expression in colorectal cancer. Biomedical Reports. 2017;6(4):423-428. PubMed |