Anti DOT1L pAb (ATL-HPA071217)

Atlas Antibodies

Catalog No.:
ATL-HPA071217-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: DOT1-like histone H3K79 methyltransferase
Gene Name: DOT1L
Alternative Gene Name: DOT1, KIAA1814, KMT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061589: 99%, ENSRNOG00000032546: 99%
Entrez Gene ID: 84444
Uniprot ID: Q8TEK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETS
Gene Sequence LIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETS
Gene ID - Mouse ENSMUSG00000061589
Gene ID - Rat ENSRNOG00000032546
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DOT1L pAb (ATL-HPA071217)
Datasheet Anti DOT1L pAb (ATL-HPA071217) Datasheet (External Link)
Vendor Page Anti DOT1L pAb (ATL-HPA071217) at Atlas Antibodies

Documents & Links for Anti DOT1L pAb (ATL-HPA071217)
Datasheet Anti DOT1L pAb (ATL-HPA071217) Datasheet (External Link)
Vendor Page Anti DOT1L pAb (ATL-HPA071217)