Anti DOT1L pAb (ATL-HPA071217)

Atlas Antibodies

Catalog No.: ATL-HPA071217-100

Protein Description: DOT1-like histone H3K79 methyltransferase
Gene Name: DOT1L
Alternative Gene Name: DOT1, KIAA1814, KMT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061589: 99%, ENSRNOG00000032546: 99%
Entrez Gene ID: 84444
Uniprot ID: Q8TEK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETS
• Gene Sequence: LIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETS
• Gene ID - Mouse: ENSMUSG00000061589
• Gene ID - Rat: ENSRNOG00000032546
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.