Anti DOPEY1 pAb (ATL-HPA027902)

Atlas Antibodies

SKU:
ATL-HPA027902-25
  • Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: dopey family member 1
Gene Name: DOPEY1
Alternative Gene Name: dJ202D23.2, KIAA1117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034973: 87%, ENSRNOG00000022847: 92%
Entrez Gene ID: 23033
Uniprot ID: Q5JWR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSVAMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGNL
Gene Sequence KLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSVAMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGNL
Gene ID - Mouse ENSMUSG00000034973
Gene ID - Rat ENSRNOG00000022847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DOPEY1 pAb (ATL-HPA027902)
Datasheet Anti DOPEY1 pAb (ATL-HPA027902) Datasheet (External Link)
Vendor Page Anti DOPEY1 pAb (ATL-HPA027902) at Atlas Antibodies

Documents & Links for Anti DOPEY1 pAb (ATL-HPA027902)
Datasheet Anti DOPEY1 pAb (ATL-HPA027902) Datasheet (External Link)
Vendor Page Anti DOPEY1 pAb (ATL-HPA027902)