Anti DONSON pAb (ATL-HPA049033 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049033-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: downstream neighbor of SON
Gene Name: DONSON
Alternative Gene Name: B17, C21orf60, C2TA, DKFZP434M035
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022960: 74%, ENSRNOG00000002012: 29%
Entrez Gene ID: 29980
Uniprot ID: Q9NYP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN
Gene Sequence KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN
Gene ID - Mouse ENSMUSG00000022960
Gene ID - Rat ENSRNOG00000002012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation)
Datasheet Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation)
Datasheet Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DONSON pAb (ATL-HPA049033 w/enhanced validation)
Citations for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) – 1 Found
Zhang, Jing; Bellani, Marina A; James, Ryan C; Pokharel, Durga; Zhang, Yongqing; Reynolds, John J; McNee, Gavin S; Jackson, Andrew P; Stewart, Grant S; Seidman, Michael M. DONSON and FANCM associate with different replisomes distinguished by replication timing and chromatin domain. Nature Communications. 2020;11(1):3951.  PubMed