Anti DONSON pAb (ATL-HPA049033 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049033-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DONSON
Alternative Gene Name: B17, C21orf60, C2TA, DKFZP434M035
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022960: 74%, ENSRNOG00000002012: 29%
Entrez Gene ID: 29980
Uniprot ID: Q9NYP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN |
Gene Sequence | KARSVNVKTQALSGYRDQFSLEITGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQLSQIPLLGKSSLRN |
Gene ID - Mouse | ENSMUSG00000022960 |
Gene ID - Rat | ENSRNOG00000002012 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) | |
Datasheet | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) | |
Datasheet | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) |
Citations for Anti DONSON pAb (ATL-HPA049033 w/enhanced validation) – 1 Found |
Zhang, Jing; Bellani, Marina A; James, Ryan C; Pokharel, Durga; Zhang, Yongqing; Reynolds, John J; McNee, Gavin S; Jackson, Andrew P; Stewart, Grant S; Seidman, Michael M. DONSON and FANCM associate with different replisomes distinguished by replication timing and chromatin domain. Nature Communications. 2020;11(1):3951. PubMed |