Anti DOLPP1 pAb (ATL-HPA019179)

Atlas Antibodies

Catalog No.:
ATL-HPA019179-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dolichyldiphosphatase 1
Gene Name: DOLPP1
Alternative Gene Name: LSFR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026856: 96%, ENSRNOG00000017663: 96%
Entrez Gene ID: 57171
Uniprot ID: Q86YN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKL
Gene Sequence TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKL
Gene ID - Mouse ENSMUSG00000026856
Gene ID - Rat ENSRNOG00000017663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DOLPP1 pAb (ATL-HPA019179)
Datasheet Anti DOLPP1 pAb (ATL-HPA019179) Datasheet (External Link)
Vendor Page Anti DOLPP1 pAb (ATL-HPA019179) at Atlas Antibodies

Documents & Links for Anti DOLPP1 pAb (ATL-HPA019179)
Datasheet Anti DOLPP1 pAb (ATL-HPA019179) Datasheet (External Link)
Vendor Page Anti DOLPP1 pAb (ATL-HPA019179)