Anti DOLPP1 pAb (ATL-HPA019179)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019179-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DOLPP1
Alternative Gene Name: LSFR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026856: 96%, ENSRNOG00000017663: 96%
Entrez Gene ID: 57171
Uniprot ID: Q86YN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKL |
| Gene Sequence | TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKL |
| Gene ID - Mouse | ENSMUSG00000026856 |
| Gene ID - Rat | ENSRNOG00000017663 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DOLPP1 pAb (ATL-HPA019179) | |
| Datasheet | Anti DOLPP1 pAb (ATL-HPA019179) Datasheet (External Link) |
| Vendor Page | Anti DOLPP1 pAb (ATL-HPA019179) at Atlas Antibodies |
| Documents & Links for Anti DOLPP1 pAb (ATL-HPA019179) | |
| Datasheet | Anti DOLPP1 pAb (ATL-HPA019179) Datasheet (External Link) |
| Vendor Page | Anti DOLPP1 pAb (ATL-HPA019179) |