Anti DOLPP1 pAb (ATL-HPA019179)
Atlas Antibodies
- SKU:
- ATL-HPA019179-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DOLPP1
Alternative Gene Name: LSFR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026856: 96%, ENSRNOG00000017663: 96%
Entrez Gene ID: 57171
Uniprot ID: Q86YN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKL |
Gene Sequence | TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKL |
Gene ID - Mouse | ENSMUSG00000026856 |
Gene ID - Rat | ENSRNOG00000017663 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DOLPP1 pAb (ATL-HPA019179) | |
Datasheet | Anti DOLPP1 pAb (ATL-HPA019179) Datasheet (External Link) |
Vendor Page | Anti DOLPP1 pAb (ATL-HPA019179) at Atlas Antibodies |
Documents & Links for Anti DOLPP1 pAb (ATL-HPA019179) | |
Datasheet | Anti DOLPP1 pAb (ATL-HPA019179) Datasheet (External Link) |
Vendor Page | Anti DOLPP1 pAb (ATL-HPA019179) |