Anti DOK7 pAb (ATL-HPA059449 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059449-25

• 
• 
• 

Protein Description: docking protein 7
Gene Name: DOK7
Alternative Gene Name: C4orf25, Dok-7, FLJ33718, FLJ39137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044716: 75%, ENSRNOG00000022419: 75%
Entrez Gene ID: 285489
Uniprot ID: Q18PE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHS
• Gene Sequence: SSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHS
• Gene ID - Mouse: ENSMUSG00000044716
• Gene ID - Rat: ENSRNOG00000022419
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.