Anti DOK7 pAb (ATL-HPA059449 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA059449-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DOK7
Alternative Gene Name: C4orf25, Dok-7, FLJ33718, FLJ39137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044716: 75%, ENSRNOG00000022419: 75%
Entrez Gene ID: 285489
Uniprot ID: Q18PE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHS |
Gene Sequence | SSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHS |
Gene ID - Mouse | ENSMUSG00000044716 |
Gene ID - Rat | ENSRNOG00000022419 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DOK7 pAb (ATL-HPA059449 w/enhanced validation) | |
Datasheet | Anti DOK7 pAb (ATL-HPA059449 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DOK7 pAb (ATL-HPA059449 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DOK7 pAb (ATL-HPA059449 w/enhanced validation) | |
Datasheet | Anti DOK7 pAb (ATL-HPA059449 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DOK7 pAb (ATL-HPA059449 w/enhanced validation) |