Anti DOK6 pAb (ATL-HPA041099)

Atlas Antibodies

Catalog No.: ATL-HPA041099-25

Protein Description: docking protein 6
Gene Name: DOK6
Alternative Gene Name: DOK5L, HsT3226, MGC20785
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073514: 98%, ENSRNOG00000038190: 98%
Entrez Gene ID: 220164
Uniprot ID: Q6PKX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
• Gene Sequence: WHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
• Gene ID - Mouse: ENSMUSG00000073514
• Gene ID - Rat: ENSRNOG00000038190
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.