Anti DOK6 pAb (ATL-HPA041099)

Atlas Antibodies

Catalog No.:
ATL-HPA041099-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: docking protein 6
Gene Name: DOK6
Alternative Gene Name: DOK5L, HsT3226, MGC20785
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073514: 98%, ENSRNOG00000038190: 98%
Entrez Gene ID: 220164
Uniprot ID: Q6PKX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
Gene Sequence WHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
Gene ID - Mouse ENSMUSG00000073514
Gene ID - Rat ENSRNOG00000038190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DOK6 pAb (ATL-HPA041099)
Datasheet Anti DOK6 pAb (ATL-HPA041099) Datasheet (External Link)
Vendor Page Anti DOK6 pAb (ATL-HPA041099) at Atlas Antibodies

Documents & Links for Anti DOK6 pAb (ATL-HPA041099)
Datasheet Anti DOK6 pAb (ATL-HPA041099) Datasheet (External Link)
Vendor Page Anti DOK6 pAb (ATL-HPA041099)