Anti DOK5 pAb (ATL-HPA054460)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054460-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DOK5
Alternative Gene Name: C20orf180, dJ805C22.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027560: 92%, ENSRNOG00000013196: 92%
Entrez Gene ID: 55816
Uniprot ID: Q9P104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH |
Gene Sequence | YWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH |
Gene ID - Mouse | ENSMUSG00000027560 |
Gene ID - Rat | ENSRNOG00000013196 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DOK5 pAb (ATL-HPA054460) | |
Datasheet | Anti DOK5 pAb (ATL-HPA054460) Datasheet (External Link) |
Vendor Page | Anti DOK5 pAb (ATL-HPA054460) at Atlas Antibodies |
Documents & Links for Anti DOK5 pAb (ATL-HPA054460) | |
Datasheet | Anti DOK5 pAb (ATL-HPA054460) Datasheet (External Link) |
Vendor Page | Anti DOK5 pAb (ATL-HPA054460) |