Anti DOK5 pAb (ATL-HPA054460)

Atlas Antibodies

Catalog No.:
ATL-HPA054460-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: docking protein 5
Gene Name: DOK5
Alternative Gene Name: C20orf180, dJ805C22.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027560: 92%, ENSRNOG00000013196: 92%
Entrez Gene ID: 55816
Uniprot ID: Q9P104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH
Gene Sequence YWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH
Gene ID - Mouse ENSMUSG00000027560
Gene ID - Rat ENSRNOG00000013196
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DOK5 pAb (ATL-HPA054460)
Datasheet Anti DOK5 pAb (ATL-HPA054460) Datasheet (External Link)
Vendor Page Anti DOK5 pAb (ATL-HPA054460) at Atlas Antibodies

Documents & Links for Anti DOK5 pAb (ATL-HPA054460)
Datasheet Anti DOK5 pAb (ATL-HPA054460) Datasheet (External Link)
Vendor Page Anti DOK5 pAb (ATL-HPA054460)