Anti DOCK5 pAb (ATL-HPA056837)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056837-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DOCK5
Alternative Gene Name: FLJ21034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044447: 92%, ENSRNOG00000024703: 92%
Entrez Gene ID: 80005
Uniprot ID: Q9H7D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL |
Gene Sequence | VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL |
Gene ID - Mouse | ENSMUSG00000044447 |
Gene ID - Rat | ENSRNOG00000024703 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DOCK5 pAb (ATL-HPA056837) | |
Datasheet | Anti DOCK5 pAb (ATL-HPA056837) Datasheet (External Link) |
Vendor Page | Anti DOCK5 pAb (ATL-HPA056837) at Atlas Antibodies |
Documents & Links for Anti DOCK5 pAb (ATL-HPA056837) | |
Datasheet | Anti DOCK5 pAb (ATL-HPA056837) Datasheet (External Link) |
Vendor Page | Anti DOCK5 pAb (ATL-HPA056837) |