Anti DOCK5 pAb (ATL-HPA056837)

Atlas Antibodies

Catalog No.:
ATL-HPA056837-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: dedicator of cytokinesis 5
Gene Name: DOCK5
Alternative Gene Name: FLJ21034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044447: 92%, ENSRNOG00000024703: 92%
Entrez Gene ID: 80005
Uniprot ID: Q9H7D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL
Gene Sequence VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL
Gene ID - Mouse ENSMUSG00000044447
Gene ID - Rat ENSRNOG00000024703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DOCK5 pAb (ATL-HPA056837)
Datasheet Anti DOCK5 pAb (ATL-HPA056837) Datasheet (External Link)
Vendor Page Anti DOCK5 pAb (ATL-HPA056837) at Atlas Antibodies

Documents & Links for Anti DOCK5 pAb (ATL-HPA056837)
Datasheet Anti DOCK5 pAb (ATL-HPA056837) Datasheet (External Link)
Vendor Page Anti DOCK5 pAb (ATL-HPA056837)