Anti DOCK3 pAb (ATL-HPA037543)

Atlas Antibodies

SKU:
ATL-HPA037543-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and neuropil was distinctly stained. .
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Western blot analysis in human cell line U-87 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dedicator of cytokinesis 3
Gene Name: DOCK3
Alternative Gene Name: KIAA0299, MOCA, PBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039716: 98%, ENSRNOG00000014576: 98%
Entrez Gene ID: 1795
Uniprot ID: Q8IZD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVPHHFFLSLKSFTYNTIGEDTDVFFSLYDMREGKQISERFLVRLNKNG
Gene Sequence FEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVPHHFFLSLKSFTYNTIGEDTDVFFSLYDMREGKQISERFLVRLNKNG
Gene ID - Mouse ENSMUSG00000039716
Gene ID - Rat ENSRNOG00000014576
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DOCK3 pAb (ATL-HPA037543)
Datasheet Anti DOCK3 pAb (ATL-HPA037543) Datasheet (External Link)
Vendor Page Anti DOCK3 pAb (ATL-HPA037543) at Atlas Antibodies

Documents & Links for Anti DOCK3 pAb (ATL-HPA037543)
Datasheet Anti DOCK3 pAb (ATL-HPA037543) Datasheet (External Link)
Vendor Page Anti DOCK3 pAb (ATL-HPA037543)