Anti DOCK1 pAb (ATL-HPA053277)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053277-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DOCK1
Alternative Gene Name: ced5, DOCK180
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058325: 94%, ENSRNOG00000018683: 94%
Entrez Gene ID: 1793
Uniprot ID: Q14185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKE |
Gene Sequence | VRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKE |
Gene ID - Mouse | ENSMUSG00000058325 |
Gene ID - Rat | ENSRNOG00000018683 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DOCK1 pAb (ATL-HPA053277) | |
Datasheet | Anti DOCK1 pAb (ATL-HPA053277) Datasheet (External Link) |
Vendor Page | Anti DOCK1 pAb (ATL-HPA053277) at Atlas Antibodies |
Documents & Links for Anti DOCK1 pAb (ATL-HPA053277) | |
Datasheet | Anti DOCK1 pAb (ATL-HPA053277) Datasheet (External Link) |
Vendor Page | Anti DOCK1 pAb (ATL-HPA053277) |