Anti DOCK1 pAb (ATL-HPA048692)

Atlas Antibodies

Catalog No.:
ATL-HPA048692-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dedicator of cytokinesis 1
Gene Name: DOCK1
Alternative Gene Name: ced5, DOCK180
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058325: 89%, ENSRNOG00000018683: 87%
Entrez Gene ID: 1793
Uniprot ID: Q14185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILSETISPLRSQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGTDVADVPPPLPLKGSVADYGNLMENQD
Gene Sequence ILSETISPLRSQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGTDVADVPPPLPLKGSVADYGNLMENQD
Gene ID - Mouse ENSMUSG00000058325
Gene ID - Rat ENSRNOG00000018683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DOCK1 pAb (ATL-HPA048692)
Datasheet Anti DOCK1 pAb (ATL-HPA048692) Datasheet (External Link)
Vendor Page Anti DOCK1 pAb (ATL-HPA048692) at Atlas Antibodies

Documents & Links for Anti DOCK1 pAb (ATL-HPA048692)
Datasheet Anti DOCK1 pAb (ATL-HPA048692) Datasheet (External Link)
Vendor Page Anti DOCK1 pAb (ATL-HPA048692)