Anti DOCK1 pAb (ATL-HPA048692)

Atlas Antibodies

Catalog No.: ATL-HPA048692-25

Protein Description: dedicator of cytokinesis 1
Gene Name: DOCK1
Alternative Gene Name: ced5, DOCK180
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058325: 89%, ENSRNOG00000018683: 87%
Entrez Gene ID: 1793
Uniprot ID: Q14185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILSETISPLRSQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGTDVADVPPPLPLKGSVADYGNLMENQD
• Gene Sequence: ILSETISPLRSQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGTDVADVPPPLPLKGSVADYGNLMENQD
• Gene ID - Mouse: ENSMUSG00000058325
• Gene ID - Rat: ENSRNOG00000018683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.