Anti DOC2B pAb (ATL-HPA043168)

Atlas Antibodies

Catalog No.:
ATL-HPA043168-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: double C2-like domains, beta
Gene Name: DOC2B
Alternative Gene Name: DOC2BL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020848: 97%, ENSRNOG00000060054: 97%
Entrez Gene ID: 8447
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKKLKPNHTKTFSICLEKQLPVDKTEDKSLEE
Gene Sequence LKKLKPNHTKTFSICLEKQLPVDKTEDKSLEE
Gene ID - Mouse ENSMUSG00000020848
Gene ID - Rat ENSRNOG00000060054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DOC2B pAb (ATL-HPA043168)
Datasheet Anti DOC2B pAb (ATL-HPA043168) Datasheet (External Link)
Vendor Page Anti DOC2B pAb (ATL-HPA043168) at Atlas Antibodies

Documents & Links for Anti DOC2B pAb (ATL-HPA043168)
Datasheet Anti DOC2B pAb (ATL-HPA043168) Datasheet (External Link)
Vendor Page Anti DOC2B pAb (ATL-HPA043168)