Anti DNTTIP2 pAb (ATL-HPA044502 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044502-25
  • Immunohistochemical staining of human testis shows moderate nucleolar positivity in subset of cells in seminiferous ducts and Leydig cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DNTTIP2 antibody. Remaining relative intensity is presented.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: deoxynucleotidyltransferase, terminal, interacting protein 2
Gene Name: DNTTIP2
Alternative Gene Name: ERBP, HSU15552, TdIF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039756: 50%, ENSRNOG00000025025: 55%
Entrez Gene ID: 30836
Uniprot ID: Q5QJE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSQESHTEAISDAETSSSDISFSGIATRRTRSMQRKLKAQTEKKDSKIVPGNEKQIVGTPVNSEDSDTRQTSHLQARSLSEINKPNFYNNDFDDDFSHR
Gene Sequence PSQESHTEAISDAETSSSDISFSGIATRRTRSMQRKLKAQTEKKDSKIVPGNEKQIVGTPVNSEDSDTRQTSHLQARSLSEINKPNFYNNDFDDDFSHR
Gene ID - Mouse ENSMUSG00000039756
Gene ID - Rat ENSRNOG00000025025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DNTTIP2 pAb (ATL-HPA044502 w/enhanced validation)
Datasheet Anti DNTTIP2 pAb (ATL-HPA044502 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DNTTIP2 pAb (ATL-HPA044502 w/enhanced validation)