Anti DNTT pAb (ATL-HPA036532)

Atlas Antibodies

Catalog No.:
ATL-HPA036532-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DNA nucleotidylexotransferase
Gene Name: DNTT
Alternative Gene Name: TDT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025014: 68%, ENSRNOG00000013615: 72%
Entrez Gene ID: 1791
Uniprot ID: P04053
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSSWQEGKTWKAIRVDLVLCPYE
Gene Sequence DEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSSWQEGKTWKAIRVDLVLCPYE
Gene ID - Mouse ENSMUSG00000025014
Gene ID - Rat ENSRNOG00000013615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DNTT pAb (ATL-HPA036532)
Datasheet Anti DNTT pAb (ATL-HPA036532) Datasheet (External Link)
Vendor Page Anti DNTT pAb (ATL-HPA036532) at Atlas Antibodies

Documents & Links for Anti DNTT pAb (ATL-HPA036532)
Datasheet Anti DNTT pAb (ATL-HPA036532) Datasheet (External Link)
Vendor Page Anti DNTT pAb (ATL-HPA036532)