Anti DNPH1 pAb (ATL-HPA029676 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029676-25

• 
• 

Protein Description: 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
Gene Name: DNPH1
Alternative Gene Name: C6orf108, dJ330M21.3, rcl
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040658: 51%, ENSRNOG00000018397: 54%
Entrez Gene ID: 10591
Uniprot ID: O43598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHV
• Gene Sequence: MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHV
• Gene ID - Mouse: ENSMUSG00000040658
• Gene ID - Rat: ENSRNOG00000018397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.